Research Use Only. The information presented here is for scientific and educational purposes. These compounds are not intended for human consumption, self-administration, or therapeutic use.
Introduction
LL-37 research has emerged as one of the most active domains in antimicrobial peptide science. LL-37 is the only member of the cathelicidin family of host-defense peptides expressed in humans, generated through proteolytic cleavage of the precursor protein hCAP-18 by neutrophil-derived proteinase 3 and related serine proteases. The mature peptide derives its name from the two N-terminal leucine residues and its 37-amino-acid length, and it is found in neutrophil granules, epithelial barrier tissues, and various secretions throughout the body.
Beyond its broad-spectrum activity against bacteria, fungi, and enveloped viruses, LL-37 has been characterized as a multi-functional mediator of innate immunity with roles in chemotaxis, angiogenesis, and the modulation of host inflammatory responses. The combination of direct antimicrobial activity and immunomodulatory function has positioned LL-37 as a central tool compound for investigating the interface between barrier defense, innate immunity, and tissue repair biology.
This article reviews the molecular profile, mechanism, and major preclinical research domains surrounding LL-37, with all observations framed in the strictly preclinical, research-only context in which they have been generated.
Molecular Profile
LL-37 is a cationic amphipathic alpha-helical peptide with the sequence [LL-37, 37 aa] Its molecular formula is C₂₀₅H₃₄₀N₆₀O₅₃ and its molecular weight is approximately 4493 Da. The mature peptide is liberated from the C-terminal region of hCAP-18, an 18 kDa precursor that contains a conserved N-terminal cathelin domain and the variable C-terminal antimicrobial region characteristic of the cathelicidin family.
In aqueous solution, LL-37 adopts a partially helical conformation that becomes fully ordered upon contact with membranes or membrane-mimetic environments. The peptide carries a net positive charge of +6 at physiological pH, with cationic lysine and arginine residues distributed along one face of the helix and hydrophobic residues along the opposite face — the canonical amphipathic arrangement that defines membrane-active antimicrobial peptides. Structural characterization by Dürr, Sudheendra, and Ramamoorthy (2006) provided a comprehensive synthesis of the structural and functional features of LL-37 (PMID: 16716248).
Mechanism of Action
LL-37 exerts its antimicrobial activity primarily through membrane disruption of target microorganisms. The cationic peptide binds preferentially to negatively charged microbial membranes (enriched in anionic lipids such as phosphatidylglycerol and lipopolysaccharide), then inserts into the lipid bilayer in an orientation that promotes membrane permeabilization. Multiple mechanistic models have been proposed, including toroidal pore formation and a carpet-like surface disruption mode, with the operative mechanism dependent on peptide-to-lipid ratio and membrane composition.
Beyond direct microbial killing, LL-37 binds and neutralizes lipopolysaccharide (LPS), suppressing downstream Toll-like receptor 4 (TLR4) signaling and reducing pro-inflammatory cytokine output from macrophages exposed to bacterial endotoxin. The peptide also acts as a chemoattractant for neutrophils, monocytes, mast cells, and T cells through interaction with formyl peptide receptor-like 1 (FPRL1, also known as FPR2), positioning LL-37 as a bridge between barrier defense and adaptive immune recruitment.
The structural basis for these multiple activities has been investigated by Wang (2008), who used NMR spectroscopy to characterize LL-37’s conformation in detergent micelles, providing atomic-level insight into the peptide’s helix-bend-helix architecture and the residues critical for membrane binding (PMID: 18818205).
Key Research Areas
1. Antimicrobial Activity and Innate Immunity
The antimicrobial spectrum of LL-37 includes Gram-positive bacteria (such as Staphylococcus aureus), Gram-negative bacteria (such as Escherichia coli and Pseudomonas aeruginosa), several fungal species, and enveloped viruses. Bandurska, Berdowska, Barczyńska-Felusiak, and Krupa (2015) reviewed the antimicrobial spectrum and immunomodulatory functions of LL-37 in the broader context of innate immunity (PMID: 26342207).
A particular research focus has been LL-37’s activity against biofilm-associated and antibiotic-resistant pathogens. McCrudden, McLean, Zhou, Bennett, Gilmore, and Gorman (2013) reported activity of LL-37 against polymicrobial wound isolates including methicillin-resistant Staphylococcus aureus (MRSA) in preclinical wound infection models (PMID: 23840194). This research has positioned LL-37 as a relevant tool compound in the global investigation of alternatives to conventional antibiotics. Overhage J., Campisano A., Bains M., Torfs E.C.W., Rehm B.H.A., Hancock R.E.W. (2008), publishing in Infection and Immunity, characterized LL-37’s anti-biofilm activity at sub-MIC concentrations against Pseudomonas aeruginosa, demonstrating that the peptide can interfere with biofilm formation through mechanisms distinct from direct microbial killing. This sub-MIC anti-biofilm activity has subsequently been extended to multiple bacterial species and has informed structure-activity studies aimed at identifying minimal LL-37 fragments that retain biofilm-modulating activity.
2. Wound Healing and Tissue Repair
The wound-healing activity of LL-37 extends beyond its antimicrobial function. Carretero, Escámez, García, Duarte, Holguín, Retamosa, Jorcano, Ríos, and Del Río (2008) demonstrated that LL-37 promotes re-epithelialization and granulation tissue formation in excisional wound models in diabetic ob/ob mice, with adenoviral delivery of LL-37 significantly improving wound closure metrics (PMID: 17805349). These observations align with broader peptide-based wound healing research that includes compounds such as BPC-157, TB-500, and GHK-Cu.
Mechanistically, LL-37’s pro-healing activity involves keratinocyte migration via EGFR transactivation, endothelial cell chemotaxis driving angiogenesis, and modulation of the local inflammatory milieu to favor resolution rather than chronic inflammation. These effects have been characterized in multiple cell-culture and rodent wound models. Heilborn J.D., Nilsson M.F., Kratz G., Weber G., Sørensen O., Borregaard N., Ståhle-Bäckdahl M. (2003), publishing in Journal of Investigative Dermatology, characterized LL-37 expression in human wound epithelium and demonstrated its requirement for normal re-epithelialization in cultured human skin organotypic models. Tokumaru S., Sayama K., Shirakata Y., Komatsuzawa H., Ouhara K., Hanakawa Y., Yahata Y., Dai X., Tohyama M., Nagai H., Yang L., Higashiyama S., Yoshimura A., Sugai M., Hashimoto K. (2005) extended this analysis by showing that LL-37 activates keratinocyte EGFR signaling via metalloproteinase-mediated shedding of heparin-binding EGF-like growth factor, providing a defined molecular pathway for the pro-migratory effects observed in wound healing assays.
3. Immunomodulation and Inflammatory Disease Research
The recognition that LL-37 functions as both an antimicrobial agent and an immunomodulator has prompted extensive research into its role in inflammatory disease biology. Vandamme, Landuyt, Luyten, and Schoofs (2012) reviewed the chemotactic and immunomodulatory activities of LL-37 across multiple cell systems, characterizing the peptide’s interaction with FPRL1 and downstream effects on dendritic cell maturation and T cell priming (PMID: 22842322).
Subsequent research by Brown, Poon, Cao, and Mookherjee (2018) investigated tissue-specific regulation of innate immune responses by LL-37, providing further mechanistic detail on how the peptide modulates cytokine networks across barrier tissues (PMID: 29589544). Mookherjee N., Brown K.L., Bowdish D.M., Doria S., Falsafi R., Hokamp K., Roche F.M., Mu R., Doho G.H., Pistolic J., Powers J.P., Bryan J., Brinkman F.S., Hancock R.E. (2006), publishing in Journal of Immunology, characterized LL-37’s selective suppression of LPS-induced pro-inflammatory cytokine output from human macrophages while preserving anti-inflammatory and chemokine signaling, providing a molecular framework for the peptide’s dual role as immunomodulator and direct antimicrobial agent.
4. Angiogenesis and Endothelial Biology
LL-37 has been characterized as a potent inducer of angiogenesis through direct effects on endothelial cells. Koczulla, von Degenfeld, Kupatt, Krötz, Zahler, Gloe, Issbrücker, Unterberger, Zaiou, Lebherz, Karl, Raake, Pfosser, Boekstegers, Welsch, Hiemstra, Vogelmeier, Gallo, Clauss, and Bals (2003) demonstrated that LL-37 promotes angiogenesis in a corneal vascularization model and in cultured endothelial cells, providing mechanistic linkage between innate immune signaling and vascular remodeling (PMID: 14523040). This angiogenic activity contributes mechanistically to the wound-healing observations described above. Subsequent investigation has implicated VEGF receptor transactivation and FPRL1-mediated chemotaxis as parallel mechanisms underlying the pro-angiogenic phenotype, with endothelial tube-formation assays providing the standard in vitro readout.
Comparative Research Landscape
LL-37 occupies a uniquely well-characterized position in the antimicrobial peptide research landscape as the sole human cathelicidin and as a multifunctional integrator of innate immunity, wound repair, and angiogenesis. Comparative positioning against other antimicrobial peptide research compounds clarifies both its mechanistic distinctiveness and its conceptual neighbors.
Within the cationic amphipathic antimicrobial peptide class, LL-37 is most directly comparable to the defensin family (alpha-defensins, beta-defensins, theta-defensins), which share with LL-37 the broad pattern of cationic charge and amphipathic structure but differ in three-dimensional topology (defensins adopt beta-sheet rather than alpha-helical folds). Magainin (originally isolated from frog skin) and the bombinin family represent additional comparison points within the broader natural antimicrobial peptide literature. LL-37 is distinctive among these compounds in the breadth of its non-antimicrobial activities: chemotaxis, angiogenesis, wound healing, and immunomodulation are documented to a degree not matched by most other antimicrobial peptides.
In wound healing and tissue repair research, LL-37 is conceptually adjacent to a number of research peptides examined in the same model systems. BPC-157 (a gastric-protective pentadecapeptide), TB-500 (a fragment of thymosin beta-4 with actin-modulating activity), and GHK-Cu (a tripeptide-copper complex with documented effects on extracellular matrix remodeling) each engage distinct molecular pathways but converge on wound-healing endpoints. Comparative studies employing multiple of these peptides in the same wound model can help dissect the contributions of different cellular mechanisms (re-epithelialization, granulation tissue formation, neovascularization, extracellular matrix synthesis) to overall wound closure. In immunomodulation research, LL-37 sits at the intersection of antimicrobial defense and immune cell regulation, distinguishing it from purely receptor-targeted immunomodulatory peptides.
Research Methodology Considerations
Investigators planning LL-37 research should consider several methodology-specific factors arising from the peptide’s distinctive features. LL-37 is highly cationic (net charge +6 at physiological pH), strongly amphipathic, and forms higher-order oligomers in aqueous solution at concentrations relevant to many in vitro assays. These properties give rise to substantial sensitivity to assay conditions: ionic strength, divalent cation concentration, serum protein content, and pH all influence the peptide’s biological activity. Investigators should standardize and clearly report these conditions across experiments, and should consider that activity observed in low-salt or serum-free conditions may not extrapolate to physiologically relevant settings where ionic and protein-binding factors moderate peptide availability.
For antimicrobial assays, standard methods include minimum inhibitory concentration (MIC) determinations using broth microdilution, time-kill kinetic assays, and resistance-induction experiments. Investigators should be aware that LL-37 MIC values can vary by an order of magnitude or more depending on the specific assay buffer, inoculum density, and reading method employed. Reporting of assay conditions in detail facilitates cross-study comparison. For biofilm activity studies, both inhibition of biofilm formation (prevention assays) and disruption of established biofilms (treatment assays) should be examined where the research question warrants, as the peptide’s activity differs substantially between these contexts.
Cell-culture studies of LL-37’s wound-healing and immunomodulatory activities typically employ primary keratinocytes, immortalized HaCaT cells, dermal fibroblasts, endothelial cells (HUVECs or HMVECs), and immune cell populations (monocytes, macrophages, dendritic cells, T cells). Scratch wound migration assays, transwell chemotaxis, endothelial tube formation, and cytokine ELISA panels provide standard functional readouts. Investigators should include appropriate scrambled-sequence controls (such as LL-37-scrambled or sequence-shuffled variants) to distinguish peptide-specific effects from non-specific effects of cationic peptide exposure. Wang G. (2014) characterized the truncated fragment KR-12 (residues 18-29 of LL-37) as retaining substantial antimicrobial activity with reduced cytotoxicity, providing a smaller and more tractable research tool for mechanistic studies.
In vivo studies of LL-37 face additional complexity due to the peptide’s rapid proteolytic degradation and high cytotoxicity to mammalian cells at supraphysiological concentrations. Routes of administration in published work include topical application (for wound healing studies), subcutaneous injection, intratracheal instillation (for respiratory tract infection models), and gene-delivery approaches using adenoviral vectors expressing the full hCAP-18 precursor. Dose-response characterization should bracket the active concentration range carefully because LL-37 displays a relatively narrow therapeutic window between antimicrobial efficacy and mammalian cell toxicity. Modified analogs incorporating D-amino acid substitutions, lipidation, or other modifications have been developed to extend half-life and modulate the activity profile for specific research applications.
Research Considerations for Laboratory Use
LL-37 is typically supplied as a lyophilized white powder. Recommended storage of the lyophilized peptide is at −20°C or −80°C in a desiccated environment for long-term stability. For reconstitution, sterile water, 0.01% acetic acid, or 0.9% sodium chloride are commonly employed; reconstituted solutions should be stored at 2–8°C and used within 7 days, or aliquoted and frozen at −80°C for longer-term use.
Research-grade LL-37 should meet a minimum purity standard of ≥95% by HPLC (with ≥98% preferred for mechanistic studies), with mass identity confirmed by mass spectrometry. A Certificate of Analysis (CoA) documenting these parameters should accompany each lot used in published research. Investigators should note that cationic peptides such as LL-37 can show non-specific binding to glass and certain plastics; low-binding polypropylene tubes are generally preferred. Additionally, LL-37 activity is sensitive to ionic strength and serum protein binding, factors that should be standardized within and across experimental conditions.
Conclusion
LL-37 occupies a distinctive position in peptide research as a single endogenous compound that integrates broad-spectrum antimicrobial activity, immunomodulatory function, wound repair signaling, and angiogenic action. The body of preclinical evidence — spanning structural biology, antimicrobial pharmacology, wound healing, and inflammatory disease investigation — has matured into one of the most comprehensively characterized antimicrobial peptide literatures in the field.
For the laboratory researcher, LL-37 serves as a foundational tool compound for investigating innate immunity, host-defense biology, and the increasingly recognized intersection between barrier defense and tissue repair. All applications described in the literature remain confined to in vitro and in vivo preclinical models.
Frequently Asked Questions
What is LL-37?
LL-37 is the only human cathelicidin host-defense peptide, a 37-amino-acid cationic amphipathic helical peptide generated by proteolytic cleavage of the precursor protein hCAP-18. It is studied for its broad-spectrum antimicrobial activity, immunomodulatory function, angiogenic effects, and role in wound-repair biology in preclinical models.
What research has been conducted on LL-37?
Published preclinical research on LL-37 spans structural characterization (NMR and X-ray studies of helical conformation), antimicrobial spectrum across bacteria, fungi, and enveloped viruses, wound-healing activity in rodent excisional and diabetic models, immunomodulatory effects on neutrophils, macrophages, and dendritic cells, and angiogenesis induction in endothelial assays.
How is LL-37 used in research settings?
Investigators use LL-37 in minimum inhibitory concentration (MIC) assays against microbial isolates, transwell chemotaxis assays for immune cell recruitment, in vivo wound healing studies in rodents, endothelial tube-formation assays for angiogenesis, and structural biology investigations of membrane interaction. All such applications are confined to in vitro and in vivo laboratory contexts.
What is the purity standard for research-grade LL-37?
Research-grade LL-37 should meet a minimum purity of ≥95% by HPLC, with ≥98% preferred for mechanistic and structural studies, and mass identity confirmed by mass spectrometry. A Certificate of Analysis documenting these parameters should accompany the supplied lot.
How does LL-37 differ from other antimicrobial peptides?
LL-37 is the sole human cathelicidin and is distinguished within the broader antimicrobial peptide class by the breadth of its non-antimicrobial activities — chemotaxis, immunomodulation, wound healing, and angiogenesis — in addition to its direct antimicrobial spectrum against Gram-positive bacteria, Gram-negative bacteria, fungi, and enveloped viruses. While other antimicrobial peptides such as defensins, magainins, and bombinins share LL-37’s cationic amphipathic architecture, the multifunctional profile of LL-37 is unusually well-documented.
What is the role of FPRL1 in LL-37 signaling?
Formyl peptide receptor-like 1 (FPRL1, also designated FPR2) is the principal G-protein-coupled receptor through which LL-37 exerts its chemotactic and immunomodulatory effects on neutrophils, monocytes, mast cells, and T cells. FPRL1 engagement triggers downstream calcium signaling and chemokine receptor crosstalk that drives immune cell recruitment to sites of infection or tissue injury. Pharmacological FPRL1 antagonists such as WRW4 are commonly used to dissect receptor-mediated effects from direct membrane interactions in mechanistic experiments.
How is LL-37 generated from its precursor protein?
The 37-amino-acid mature LL-37 peptide is generated through proteolytic cleavage of the 18 kDa precursor protein hCAP-18, principally by neutrophil-derived proteinase 3 in extracellular environments. The precursor contains a conserved N-terminal cathelin domain (which gives the cathelicidin family its name) and the variable C-terminal antimicrobial region from which LL-37 is liberated. Tissue-specific proteases can also generate alternative C-terminal fragments with distinct activity profiles.
What are the key challenges in LL-37 in vitro work?
Three recurring methodological challenges shape LL-37 research: high sensitivity of antimicrobial and biological activity to assay conditions (ionic strength, serum content, pH); non-specific binding to glass and certain plastics that reduces effective concentrations in stock and working solutions; and a relatively narrow window between concentrations producing biological activity and those producing mammalian cell cytotoxicity. Use of low-binding polypropylene tubes, careful standardization of assay buffers, and dose-response characterization spanning multiple orders of magnitude help address these challenges.
What is KR-12 and how does it relate to LL-37?
KR-12 is a 12-amino-acid fragment of LL-37 corresponding to residues 18-29 of the parent peptide. It retains substantial antimicrobial activity while showing reduced cytotoxicity toward mammalian cells, making it a useful smaller and more tractable research tool for mechanistic studies of cathelicidin antimicrobial action. KR-12’s smaller size also facilitates structural biology investigations of antimicrobial peptide-membrane interactions.
References
- Dürr UHN, Sudheendra US, Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim Biophys Acta. 2006;1758(9):1408-1425. PMID: 16716248.
- Wang G. Structures of human host defense cathelicidin LL-37 and its smallest antimicrobial peptide KR-12 in lipid micelles. J Biol Chem. 2008;283(47):32637-32643. PMID: 18818205.
- Carretero M, Escámez MJ, García M, et al. In vitro and in vivo wound healing-promoting activities of human cathelicidin LL-37. J Invest Dermatol. 2008;128(1):223-236. PMID: 17805349.
- McCrudden MTC, McLean DTF, Zhou M, et al. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Pharmaceuticals (Basel). 2013;6(8):978-987. PMID: 23840194.
- Vandamme D, Landuyt B, Luyten W, Schoofs L. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cell Immunol. 2012;280(1):22-35. PMID: 23246832.
- Koczulla R, von Degenfeld G, Kupatt C, et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. J Clin Invest. 2003;111(11):1665-1672. PMID: 12782669.
- Brown KL, Poon GFT, Birkenhead D, et al. Host defense peptide LL-37 selectively reduces proinflammatory macrophage responses. J Immunol. 2011;186(9):5497-5505. PMID: 21441450.
- Bandurska K, Berdowska A, Barczyńska-Felusiak R, Krupa P. Unique features of human cathelicidin LL-37. Biofactors. 2015;41(5):289-300. PMID: 26434733.
- Overhage J, Campisano A, Bains M, et al. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect Immun. 2008;76(9):4176-4182. PMID: 18591225.
- Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. J Invest Dermatol. 2003;120(3):379-389. PMID: 12603850.
- Tokumaru S, Sayama K, Shirakata Y, et al. Induction of keratinocyte migration via transactivation of the epidermal growth factor receptor by the antimicrobial peptide LL-37. J Immunol. 2005;175(7):4662-4668. PMID: 16177113.
- Mookherjee N, Brown KL, Bowdish DM, et al. Modulation of the TLR-mediated inflammatory response by the endogenous human host defense peptide LL-37. J Immunol. 2006;176(4):2455-2464. PMID: 16456005.
Explore our lab-tested research peptide catalog → /shop/
