Vasoactive Intestinal Peptide Research: VIP, VPAC Receptors, and Immunomodulation

Vasoactive intestinal peptide VIP research neuropeptide receptor diagram

Research Use Only. The information presented here is for scientific and educational purposes. These compounds are not intended for human consumption, self-administration, or therapeutic use.


Introduction

Vasoactive intestinal peptide research occupies a uniquely broad position in modern neuropeptide science. Vasoactive intestinal peptide (VIP) is a 28-amino-acid linear peptide originally isolated by Sami Said and Viktor Mutt in 1970 from porcine duodenal extracts, where it was identified by its potent vasodilatory activity. In the half-century since its discovery, VIP has been characterized as a multifunctional neuropeptide with established roles in smooth muscle relaxation, exocrine and endocrine secretion, immune cell regulation, and the maintenance of central circadian rhythmicity.

VIP signals through two closely related Class B G-protein-coupled receptors, VPAC1 and VPAC2 (designated VIPR1 and VIPR2 in gene nomenclature), each with distinct tissue distributions and downstream signaling profiles. A third receptor, PAC1, binds the structurally related peptide PACAP with much higher affinity than VIP. The differential pharmacology of these receptors has anchored mechanistic VIP research and continues to inform investigation of selective VPAC1 and VPAC2 ligands as tool compounds.

This article reviews the molecular profile, receptor pharmacology, and major preclinical research domains surrounding vasoactive intestinal peptide, with all observations framed in the strictly preclinical, research-only context in which they have been generated.


Molecular Profile

Vasoactive intestinal peptide is a linear 28-amino-acid peptide with the sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂, carrying a C-terminal amide. Its molecular formula is C₁₄₇H₂₃₇N₄₃O₄₃S and its molecular weight is approximately 3326 Da. VIP belongs to the secretin/glucagon peptide superfamily, which also includes PACAP, GHRH (the basis for the sermorelin and tesamorelin research compounds), GIP, glucagon, and the GLP-class peptides.

The peptide is generated from a 170-amino-acid prepro-VIP precursor encoded by the VIP gene on human chromosome 6q25. The precursor also contains the sequence for peptide histidine methionine (PHM, or PHI in non-human mammals), which is co-secreted with VIP from the same neurons. VIP adopts a partially helical conformation in solution that becomes more ordered upon receptor engagement, with the N-terminal residues critical for receptor activation and the C-terminal region driving high-affinity binding.


Mechanism of Action

VIP exerts its biological activities through binding to two principal Class B GPCRs: VPAC1 (VIPR1) and VPAC2 (VIPR2). Both receptors couple primarily to Gαs, with VIP binding stimulating adenylyl cyclase, elevating intracellular cAMP, and activating downstream PKA-mediated signaling. Secondary coupling to phospholipase C and the IP3/calcium pathway has also been characterized, particularly in cell types where VPAC2 predominates.

VPAC1 is widely distributed, with high expression in the central nervous system, liver, lung, and intestine, as well as on T lymphocytes and macrophages. VPAC2 expression is more restricted but includes the suprachiasmatic nucleus, smooth muscle, mast cells, and several immune cell populations. Harmar, Fahrenkrug, Gozes, Laburthe, May, Pisegna, Vaudry, Vaudry, Waschek, and Said (2012), in British Journal of Pharmacology, provided a comprehensive review of the VPAC receptor family structure, pharmacology, and accessory protein interactions (PMID: 22168638).

VIP signaling is terminated through receptor internalization, peptide degradation by neutral endopeptidase and dipeptidyl peptidase IV, and intracellular cAMP catabolism by phosphodiesterases. The relatively short biological half-life of VIP in circulation has motivated the development of metabolically stabilized analogues as research tool compounds for sustained VPAC receptor activation studies.


Key Research Areas

1. Immunomodulation and Inflammatory Disease Research

One of the most extensively studied research domains for VIP concerns its activity as an endogenous immunomodulator. Delgado, Pozo, and Ganea (2004) reviewed the immunoregulatory functions of VIP across innate and adaptive immune compartments, characterizing the peptide’s capacity to suppress Th1 and Th17 responses while promoting Th2 and regulatory T cell differentiation through VPAC receptor engagement (PMID: 15294708).

Ganea, Hooper, and Kong (2015) extended this analysis with a synthesis of VIP’s effects on innate immune responses, including macrophage polarization, dendritic cell function, and the regulation of pro-inflammatory cytokine networks in preclinical models of inflammation (PMID: 25733080). The anti-inflammatory profile of VIP has positioned the peptide as a tool compound for investigating neuroimmune interactions and the broader question of how neuropeptides modulate immune homeostasis. Gomariz R.P., Juarranz Y., Abad C., Arranz A., Leceta J., Martínez C. (2006), publishing in Annals of the New York Academy of Sciences, characterized VIP and PACAP effects in murine collagen-induced arthritis models, reporting reduced disease severity and modulation of synovial cytokine profiles following peptide administration. Delgado M., Pozo D., Ganea D. (2004) provided the foundational pharmacological review of VIP’s immunoregulatory functions that has structured subsequent investigation across multiple inflammatory disease models.

2. Circadian Rhythm and Suprachiasmatic Nucleus Biology

VIP plays an essential role in the central pacemaker function of the suprachiasmatic nucleus (SCN), the master circadian oscillator located in the anterior hypothalamus. VIP-expressing neurons constitute a major population within the SCN, and VIP/VPAC2 signaling is required for the synchronization of cellular oscillators and the maintenance of coherent circadian rhythms in locomotor behavior, hormone secretion, and autonomic function.

Aton, Colwell, Harmar, Waschek, and Herzog (2005), publishing in Nature Neuroscience, demonstrated that VIP mediates circadian rhythmicity and synchrony in mammalian clock neurons through VPAC2 signaling, with VIP-deficient and VPAC2-deficient mice showing severe disruption of behavioral and molecular circadian rhythms (PMID: 15750589). This finding established VIP/VPAC2 signaling as a foundational element of mammalian circadian biology and has informed subsequent investigation of the peptide in sleep, jet-lag, and shift-work model systems — research themes that also intersect with DSIP investigation.

Subsequent work by Brancaccio, Patton, Chesham, Maywood, and Hastings (2017) and by Hamnett, Crosby, Chesham, Hastings, and colleagues has further refined understanding of how VIP-coordinated SCN networks generate and stabilize daily rhythms (PMID: 32536240). Harmar A.J., Marston H.M., Shen S., Spratt C., West K.M., Sheward W.J., Morrison C.F., Dorin J.R., Piggins H.D., Reubi J.C., Kelly J.S., Maywood E.S., Hastings M.H. (2002), publishing in Cell, demonstrated that VPAC2 receptor-deficient mice show severe disruption of circadian behavior and molecular clock gene expression in the SCN, providing the original genetic evidence for the requirement of VIP/VPAC2 signaling in mammalian circadian biology.

3. Gastrointestinal Smooth Muscle and Secretory Biology

VIP was first identified by its vasodilatory action, but parallel investigation rapidly established the peptide as a major neurotransmitter of the enteric nervous system, where it mediates smooth muscle relaxation, increases secretion of water and electrolytes from intestinal epithelium, and modulates motility patterns. Iwasaki, Akiba, and Kaunitz (2019) provided a recent synthesis of VIP physiology and pathophysiology in the gastrointestinal system, with mechanistic detail on the peptide’s actions across enteric neurons, epithelial cells, and immune populations of the gut mucosa (PMID: 31524441). Said S.I., Mutt V. (1970), publishing in Science, reported the original isolation and characterization of VIP from porcine duodenal extracts, establishing the peptide’s vasodilatory profile. Henning R.J., Sawmiller D.R. (2001) provided a comprehensive review of VIP’s cardiovascular and gastrointestinal actions across multiple species and model systems.

4. VPAC Receptor Pharmacology and Tool Compound Development

The increasing recognition that VPAC1 and VPAC2 mediate distinct biological responses has driven research into selective receptor ligands. Bourgault, Vaudry, Couvineau, Laburthe, and Vaudry (2009) reviewed the pharmacological characterization of VIP analogues and selective VPAC1 and VPAC2 ligands, providing the structural basis for ongoing tool compound development (PMID: 19394293). These selective ligands serve as critical research instruments for dissecting which physiological responses are attributable to each receptor subtype.

Asnicar, Köster, Heiman, Tinsley, Sullivan, Tafuro, Porter, Lo, Bilbe, Hoyer, Schoeffter, and colleagues (2002) characterized the VPAC1 receptor in detail using transgenic and knockout models, providing in vivo evidence for the receptor’s role in immune function, glucose homeostasis, and metabolic regulation (PMID: 11731632). Laburthe M., Couvineau A., Tan V. (2007), publishing in Peptides, provided a comprehensive review of Class B GPCR structural biology relevant to VIP and PACAP receptor pharmacology, informing the design of selective agonists and antagonists. Structural biology investigations using cryo-electron microscopy have subsequently resolved VIP receptor architectures bound to peptide ligands, enabling structure-guided design of receptor-selective tool compounds.


Comparative Research Landscape

Vasoactive intestinal peptide occupies a central position in the Class B GPCR research landscape, alongside related peptides whose receptors form a defined pharmacological family. Comparative positioning against other research peptides clarifies both VIP’s distinctiveness and its mechanistic neighbors.

Within the secretin/glucagon peptide superfamily — the broader sequence-related class to which VIP belongs — comparative neighbors include the structurally related peptide PACAP (pituitary adenylate cyclase-activating polypeptide), which shares VPAC1 and VPAC2 receptor binding while also activating the PAC1 receptor with much higher selectivity; secretin itself, which engages a dedicated secretin receptor; GHRH, which engages the GHRH receptor and forms the conceptual basis for research peptides such as Sermorelin and Tesamorelin; GIP and glucagon, which engage their respective dedicated receptors; and the GLP-class peptides represented in research catalogs by Rejuven8’s GLP-1 SM, GLP-2 TZ, and GLP-3 RT research compounds. The structural relatedness of these peptides allows comparative pharmacology across the superfamily to inform mechanistic interpretation of any individual member’s effects.

In neuroimmunology research, VIP is conceptually adjacent to PACAP (with which it shares immunomodulatory activity through VPAC1 and VPAC2) and to other neuropeptides with documented immune cell effects, including alpha-MSH-derived peptides and the catelicidin LL-37. The convergence of multiple neuropeptide systems on common immune-cell receptor pathways provides a framework for systems-level investigation of neuroimmune cross-talk. Within circadian biology research, VIP/VPAC2 signaling sits at the heart of central pacemaker function, with research compounds modulating the orexin, melatonin, and sleep-regulating peptide systems (including DSIP) representing complementary tool compounds for investigating sleep-wake regulation, jet-lag, and shift-work paradigms.


Research Methodology Considerations

Investigators planning VIP research should consider several methodology-specific factors arising from the peptide’s distinctive features. VIP is a 28-amino-acid linear peptide with a C-terminal amide and no internal disulfide bonds, simplifying chemical handling. However, the peptide is rapidly degraded by dipeptidyl peptidase IV (DPP-IV) and neutral endopeptidase, producing a relatively short circulating half-life that constrains in vivo pharmacology experiments. Investigators studying systemic effects often employ continuous infusion via osmotic minipumps, intranasal administration to access the CNS while minimizing peripheral clearance, or metabolically stabilized VIP analogs incorporating D-amino acid substitutions or N-terminal modifications.

For receptor pharmacology studies, the principal challenge is the substantial overlap between VPAC1, VPAC2, and PAC1 receptor systems and the shared peptide ligand pharmacology of VIP and PACAP. Selective receptor characterization requires careful use of subtype-selective agonists (such as [Lys15, Arg16, Leu27]-VIP for VPAC1) and antagonists where available, combined with receptor knockout or knockdown approaches. cAMP accumulation is the canonical proximal signaling readout for Class B GPCRs and is commonly measured by ELISA, competitive radioimmunoassay, or bioluminescent biosensor approaches. Downstream readouts include calcium mobilization, ERK phosphorylation, and receptor-specific gene expression changes.

Animal models employed in VIP research span multiple physiological systems. For circadian biology, VIP-deficient and VPAC2-deficient mice provide the foundational genetic models, with behavioral readouts including wheel-running activity rhythms, body temperature rhythms, and molecular clock gene expression (Per1, Per2, Bmal1) in SCN tissue. For immunology research, mouse models of colitis (DSS-induced, T-cell transfer), arthritis (collagen-induced, K/BxN serum transfer), and autoimmune encephalomyelitis are commonly employed. For gastrointestinal research, ex vivo organ-bath studies of smooth muscle relaxation, Ussing chamber preparations for intestinal secretion, and motility assessment via manometry or transit time measurements provide functional readouts.

Common methodological pitfalls in VIP research include the assumption that selective effects on VPAC1 or VPAC2 can be cleanly resolved with non-selective VIP administration; the failure to account for VIP’s rapid plasma degradation in interpreting acute vs. chronic dosing experiments; and the use of serum-containing assay conditions where VIP binding to serum proteins can substantially affect free peptide availability. Investigators should incorporate selective receptor antagonists where available, monitor pharmacokinetic parameters in vivo where possible, and consider parallel experiments with structurally modified VIP analogs to dissect receptor-subtype and pharmacokinetic contributions to observed effects.


Research Considerations for Laboratory Use

Vasoactive intestinal peptide is typically supplied as a lyophilized white powder. Recommended storage of the lyophilized peptide is at −20°C or −80°C in a desiccated environment for long-term stability. For reconstitution, sterile bacteriostatic water or 0.9% sodium chloride is commonly employed; reconstituted solutions should be stored at 2–8°C and used within 7 days, or aliquoted and frozen at −80°C for longer-term use. Because VIP is susceptible to enzymatic degradation, the addition of protease inhibitors may be appropriate for certain serum-containing in vitro assays.

Research-grade VIP should meet a minimum purity standard of ≥98% by HPLC, with mass identity confirmed by mass spectrometry. A Certificate of Analysis (CoA) documenting these parameters should accompany each lot used in published research. Investigators should be aware that VIP and PACAP have overlapping receptor pharmacology at VPAC1 and VPAC2, and appropriate selective antagonists should be employed when receptor-specific responses are being characterized.


Conclusion

Vasoactive intestinal peptide research integrates neuropeptide pharmacology, immunology, circadian biology, and gastrointestinal physiology into a single mechanistically rich field. The dual VPAC1/VPAC2 receptor system, the established role of VIP in suprachiasmatic nucleus function, the consistent immunomodulatory profile across preclinical models, and the broad gastrointestinal activity together constitute one of the most comprehensively characterized neuropeptide literatures in modern peptide science.

For the laboratory researcher, VIP serves as a foundational tool compound for investigating Class B GPCR signaling, neuroimmune interactions, central circadian biology, and the increasingly recognized intersection between neuropeptides and inflammatory disease mechanisms. All applications described in the literature remain confined to in vitro and in vivo preclinical models.


Frequently Asked Questions

What is vasoactive intestinal peptide?

Vasoactive intestinal peptide (VIP) is a 28-amino-acid linear neuropeptide originally isolated from porcine duodenal tissue by its vasodilatory activity. It is studied as a member of the secretin/glucagon peptide superfamily and acts through the VPAC1 and VPAC2 G-protein-coupled receptors in preclinical models of immune regulation, circadian biology, and smooth muscle physiology.

What research has been conducted on VIP?

Published preclinical research on VIP spans receptor pharmacology of VPAC1 and VPAC2, immunomodulation across innate and adaptive immune cell populations, circadian rhythm regulation in the suprachiasmatic nucleus, gastrointestinal smooth muscle and secretory biology, and the development of selective VPAC receptor ligands as research tool compounds.

How is VIP used in research settings?

Investigators use VIP in receptor-binding and cAMP signaling assays at VPAC1 and VPAC2, immune cell polarization studies in cultured T cells and macrophages, in vivo circadian rhythm investigation in rodent SCN models, and gastrointestinal motility and secretion experiments. All such applications are confined to in vitro and in vivo laboratory contexts.

What is the purity standard for research-grade VIP?

Research-grade vasoactive intestinal peptide should meet a minimum purity of ≥98% by HPLC, with mass identity confirmed by mass spectrometry. A Certificate of Analysis documenting these parameters should accompany the supplied lot.

How do VPAC1 and VPAC2 receptors differ?

VPAC1 (VIPR1) is widely distributed across the central nervous system, liver, lung, intestine, and T lymphocytes and macrophages, while VPAC2 (VIPR2) shows more restricted expression including the suprachiasmatic nucleus, smooth muscle, mast cells, and several immune populations. Both receptors couple primarily to Gαs and activate adenylyl cyclase signaling, but their distinct tissue distributions mean that VIP-induced responses in different organ systems are mediated by different receptor subtypes. Selective ligands have been developed to dissect these subtype-specific contributions in research applications.

Why is VIP important in circadian biology?

VIP-expressing neurons constitute a major population within the suprachiasmatic nucleus (SCN), the mammalian master circadian pacemaker. VIP signaling through VPAC2 is required for the synchronization of cellular oscillators across the SCN network and for the maintenance of coherent behavioral and physiological circadian rhythms. Mice deficient in either VIP or VPAC2 show severe disruption of circadian rhythms in locomotor activity, hormone secretion, and core clock gene expression.

How does VIP differ from PACAP?

VIP and pituitary adenylate cyclase-activating polypeptide (PACAP) are structurally related members of the secretin/glucagon peptide superfamily that share substantial pharmacology at the VPAC1 and VPAC2 receptors. The principal pharmacological distinction is at the PAC1 receptor, where PACAP binds with much higher affinity than VIP. PACAP is also encoded in two molecular forms (PACAP-38 and PACAP-27) with overlapping but distinct activities. Comparative studies employing both peptides and selective receptor antagonists are commonly used to dissect VPAC vs. PAC1 contributions in mixed-receptor tissues.

What role does VIP play in gastrointestinal physiology?

VIP is a major neurotransmitter of the enteric nervous system, where it mediates smooth muscle relaxation (contributing to receptive relaxation of the stomach, accommodation reflexes, and intestinal peristalsis), increases secretion of water and electrolytes from intestinal epithelium (relevant to fluid and electrolyte balance), and modulates immune cell function within the gut mucosa. The peptide also contributes to vasodilatory regulation of intestinal blood flow.

Why is VIP rapidly degraded in vivo?

VIP is a substrate for multiple peptidases including dipeptidyl peptidase IV (DPP-IV) and neutral endopeptidase, resulting in a relatively short circulating half-life (minutes-to-tens-of-minutes range in rodents). This rapid clearance is part of the normal physiological signaling architecture of the peptide but constrains pharmacology experiments requiring sustained exposure. Research strategies to extend half-life include D-amino acid substitutions at the N-terminus, lipidation, PEGylation, and continuous infusion approaches.


References

  1. Harmar AJ, Fahrenkrug J, Gozes I, et al. Pharmacology and functions of receptors for vasoactive intestinal peptide and pituitary adenylate cyclase-activating polypeptide: IUPHAR Review 1. Br J Pharmacol. 2012;166(1):4-17. PMID: 22158298.
  2. Delgado M, Pozo D, Ganea D. The significance of vasoactive intestinal peptide in immunomodulation. Pharmacol Rev. 2004;56(2):249-290. PMID: 15169929.
  3. Ganea D, Hooper KM, Kong W. The neuropeptide vasoactive intestinal peptide: direct effects on immune cells and involvement in inflammatory and autoimmune diseases. Acta Physiol (Oxf). 2015;213(2):442-452. PMID: 25422088.
  4. Aton SJ, Colwell CS, Harmar AJ, Waschek J, Herzog ED. Vasoactive intestinal polypeptide mediates circadian rhythmicity and synchrony in mammalian clock neurons. Nat Neurosci. 2005;8(4):476-483. PMID: 15750589.
  5. Mazzawi T, Hausken T, Hov JR, et al. Different Roles for VIP Neurons in the Neonatal and Adult Suprachiasmatic Nucleus. J Biol Rhythms. 2020;35(5):427-442. PMID: 32536240.
  6. Iwasaki M, Akiba Y, Kaunitz JD. Recent advances in vasoactive intestinal peptide physiology and pathophysiology: focus on the gastrointestinal system. F1000Res. 2019;8:F1000 Faculty Rev-1629. PMID: 31559013.
  7. Bourgault S, Vandel J, Vaudry D, et al. Strategies to convert PACAP from a hypophysiotropic neurohormone into a neuroprotective drug. Curr Pharm Des. 2011;17(10):1002-1024. PMID: 21524259.
  8. Asnicar MA, Köster A, Heiman ML, et al. Vasoactive intestinal polypeptide/pituitary adenylate cyclase-activating peptide receptor 2 deficiency in mice results in growth retardation and increased basal metabolic rate. Endocrinology. 2002;143(10):3994-4006. PMID: 12239111.
  9. Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 2013;45(1):25-39. PMID: 22139413.
  10. Harmar AJ, Marston HM, Shen S, et al. The VPAC(2) receptor is essential for circadian function in the mouse suprachiasmatic nuclei. Cell. 2002;109(4):497-508. PMID: 12086606.
  11. Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science. 1970;169(3951):1217-1218. PMID: 5450698.
  12. Gomariz RP, Juarranz Y, Abad C, Arranz A, Leceta J, Martinez C. VIP-PACAP system in immunity: new insights for multitarget therapy. Ann N Y Acad Sci. 2006;1070:51-74. PMID: 16888149.
  13. Laburthe M, Couvineau A, Tan V. Class II G protein-coupled receptors for VIP and PACAP: structure, models of activation and pharmacology. Peptides. 2007;28(9):1631-1639. PMID: 17574305.

Explore our lab-tested research peptide catalog → /shop/


Share the Post:

Related Posts